| Title | The crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase from Yersinia pestis CO92. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00571 | | Molecular Characteristics | | Source | Yersinia pestis co92 | | Alias Ids | TPS26751,214092, 16121341 | Molecular Weight | 29935.63 Da. | | Residues | 274 | Isoelectric Point | 5.68 | | Sequence | mqqlqnvietaferraditpanvdtvtreaithvidlldtgalrvaekidgqwvthqwlkkavllsfri ndnqvmegaetryydkvpmkfagydearfqregfrvvppatvrkgafiarntvlmpsyvnigafvdegt mvdtwatvgscaqigknvhlsggvgiggvleplqanptiiedncfvgarsevvegviveegsvismgvf igqstriydretgevhygrvpagsvvvsgnlpskdgsyslycavivkkvdaktrskvginellrtid | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 1.80 | Rfree | 0.27198 | | Matthews' coefficent | 2.28 | Rfactor | 0.22710 | | Waters | 285 | Solvent Content | 46.14 |
| Ligand Information | | Ligands | | | Metals | MG (MAGNESIUM) x 1 | | |
