| Title | 1.25 Angstrom Crystal Structure of Pyrrolidone-Carboxylate Peptidase (pcp) from Staphylococcus aureus. TO BE PUBLISHED | | Site | CSGID | | PDB Id | | Target Id | IDP00836 | | Molecular Characteristics | | Source | Staphylococcus aureus subsp. aureus col | | Alias Ids | TPS26771,93062, 57285268 | Molecular Weight | 23165.98 Da. | | Residues | 212 | Isoelectric Point | 5.21 | | Sequence | mhilvtgfapfdnqninpsweavtqlediigthtidklklptsfkkvdniinktlasnhydvvlaigqa ggrnaitpervainiddaripdnddfqpidqaihldgapayfsnlpvkamtqsiinqglpgalsnsagt fvcnhtlyhlgylqdkhyphlrfgfihvpyipeqvigkpdtpsmplekivagltaaieaisndedlhla lgtte | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.25 | Rfree | 0.14782 | | Matthews' coefficent | 2.20 | Rfactor | 0.11616 | | Waters | 706 | Solvent Content | 44.12 |
| Ligand Information | | Ligands | ACY (ACETIC) x 2;PG4 (TETRAETHYLENE) x 3;GOL (GLYCEROL) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1 | | Metals | ZN (ZINC) x 2 | | |
