| Title | X-ray crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01038 | | Molecular Characteristics | | Source | Salmonella enterica subsp. enterica serovar typhimurium str. lt2 | | Alias Ids | TPS26786,99287, 16766235 | Molecular Weight | 16898.62 Da. | | Residues | 159 | Isoelectric Point | 6.05 | | Sequence | mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigklfpdtdpafk gadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedlgchmdevnvkattteklg ftgrgegiaceavallmkaak | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.03 | Rfree | 0.205 | | Matthews' coefficent | 2.41 | Rfactor | 0.166 | | Waters | 198 | Solvent Content | 48.97 |
| Ligand Information | | Ligands | GOL (GLYCEROL) x 2;POP (PYROPHOSPHATE) x 1 | | Metals | MG (MAGNESIUM) x 4 | | |
