| Title | Crystal Structure of IcaR from Staphylococcus aureus, a member of the tetracycline repressor protein family. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00851 | | Molecular Characteristics | | Source | Staphylococcus aureus subsp. aureus col | | Alias Ids | TPS26773,93062, 57286591 | Molecular Weight | 21985.93 Da. | | Residues | 186 | Isoelectric Point | 5.17 | | Sequence | mkdkiidnaitlfsekgydgttlddiaksvnikkaslyyhfdskksiyeqsvkccfdylnniimmnqnk snysidalyqflfefifdieeryirmyvqlsntpeefsgniygqiqdlnqslskeiakfydeskikmtk edfqnlillfleswylkasfsqkfgaveesksqfkdevysllniflkk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.90 | Rfree | 0.228 | | Matthews' coefficent | 2.36 | Rfactor | 0.182 | | Waters | 441 | Solvent Content | 47.94 |
| Ligand Information | | Ligands | FMT (FORMIC) x 10 | | Metals | NA (SODIUM) x 1;CL (CHLORIDE) x 5 | | |
