| Title | Crystal structure of chaperone CsaA form Bacillus anthracis str. Ames. TO BE PUBLISHED | | Site | CSGID | | PDB Id | | Target Id | IDP01112 | | Molecular Characteristics | | Source | Bacillus anthracis str. ames | | Alias Ids | TPS26792,198094, 30256713 | Molecular Weight | 11937.17 Da. | | Residues | 109 | Isoelectric Point | 4.93 | | Sequence | manfedfltldlrigtvthaeefkearvpaikleidfgelgmkqssaqitkrynpedligqqivavvnf ppkrvagfksevlvlggvpeagdvvllqpnmelpngtkis | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.50 | Rfree | 0.20057 | | Matthews' coefficent | 2.03 | Rfactor | 0.16564 | | Waters | 256 | Solvent Content | 39.27 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 1;SO4 (SULFATE) x 1;GOL (GLYCEROL) x 2 | | Metals | | | |
