| Title | The crystal structure of the peptide deformylase from Vibrio cholerae O1 biovar El Tor. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01357 | | Molecular Characteristics | | Source | Vibrio cholerae o1 biovar el tor str. n16961 | | Alias Ids | TPS26796,243277, 15640078 | Molecular Weight | 19146.02 Da. | | Residues | 169 | Isoelectric Point | 4.90 | | Sequence | msvlqvltfpddrlrtvakpveqvtpeiqqivddmletmyaeegiglaatqvdihqrivvidisetrdq pmvlinpeiiekrgedgieegclsvpgaralvpraaevtvkaldrngqeyqfdaddllaicvqheldhl agklfvdylsplkrnrikeklekikrfnekk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.26234 | | Matthews' coefficent | 2.56 | Rfactor | 0.20204 | | Waters | 289 | Solvent Content | 51.92 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 2 | | |
