.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fww

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The crystal structure of the bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase from Yersinia pestis CO92. To be Published
    Site CSGID
    PDB Id 3fww Target Id IDP00427
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS26738,214092, 16124227 Molecular Weight 48837.22 Da.
    Residues 456 Isoelectric Point 6.02
    Sequence msnssmsvvilaagkgtrmysdlpkvlhplagkpmvqhvidaamklgaqhvhlvyghggellkktladp slnwvlqaeqlgtghamqqaaphfaddedilmlygdvplisvdtlqrllaakpeggiglltvkldnpsg ygrivrengdvvgivehkdasdaqreineintgilvangrdlkrwlslldnnnaqgefyitdiialaha dgkkiatvhptrlsevegvnnrlqlsalervfqteqaeklllagvmlldpsrfdlrgelthgrditidt nviieghvilgdrvrigtgcvlkncvigddseispytvledarldanctvgpfarlrpgaelaegahvg nfveikkarlgkgskaghlsylgdaeigagvnigagtitcnydgankfktiigddvfvgsdtqlvapvt vangatigagttvtrdvaenelvisrvkqvhiqgwkrpvkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2766
    Matthews' coefficent 2.90 Rfactor 0.2142
    Waters 25 Solvent Content 57.59

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch