| Title | Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase IspF complexed with Cytidine Triphosphate. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00520 | | Related PDB Ids 3f6m | | Molecular Characteristics | | Source | Yersinia pestis co92 | | Alias Ids | TPS26746,214092, 16123510 | Molecular Weight | 17180.76 Da. | | Residues | 162 | Isoelectric Point | 5.82 | | Sequence | mrighgfdvhkfgengsgpliiggvripyekgllahsdgdvalhaatdallgaaalgdigklfpdtdpa fkgadsrgllreayrrilakgyklgnlditiiaqapkmaphipqmrvnlaedlqchmddinvkattteq lgftgrgegiaceavvllvnveqg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.80 | Rfree | 0.199 | | Matthews' coefficent | | Rfactor | 0.170 | | Waters | 76 | Solvent Content | |
| Ligand Information | | Ligands | CTP (CYTIDINE-5'-TRIPHOSPHATE) x 1;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1;SO4 (SULFATE) x 1 | | Metals | MG (MAGNESIUM) x 2;CL (CHLORIDE) x 1 | | |
