| Title | Crystal Structure of Pyridoxal Phosphate Biosynthetic Protein PdxJ from Yersinia pestis. To be Published 2008 | | Site | CSGID | | PDB Id | | Target Id | IDP00439 | | Molecular Characteristics | | Source | Yersinia pestis co92 | | Alias Ids | TPS26740,214092, 16123117 | Molecular Weight | 26295.87 Da. | | Residues | 243 | Isoelectric Point | 5.69 | | Sequence | madlllgvnidhiatlrnargtiypdpvqaafiaeqagadgitvhlredrrhitdrdvrilrqtiqtrm nlemavtdemvdiacdikphfcclvpekrqevtteggldvagqvdkmtlavgrladvgilvslfidadf rqidaavaagapyieihtgayadastvlerqaelmriakaatyaagkglkvnaghgltyhnvqpiaalp emhelnighaiigqavmtglaaavtdmkvlmrearr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 8 | | Resolution (Å) | 2.40 | Rfree | 0.266 | | Matthews' coefficent | 2.36 | Rfactor | 0.191 | | Waters | 667 | Solvent Content | 47.99 |
| Ligand Information | | Ligands | PXP (PYRIDOXINE-5'-PHOSPHATE) x 8;SO4 (SULFATE) x 3 | | Metals | | | |
