| Title | X-ray crystal structure of Arsenate reductase from Vibrio cholerae. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01300 | | Molecular Characteristics | | Source | Vibrio cholerae o1 biovar el tor str. n16961 | | Alias Ids | TPS26794,243277, 15642164 | Molecular Weight | 13172.58 Da. | | Residues | 116 | Isoelectric Point | 5.92 | | Sequence | msvviyhnpkcsksretlallenqgiapqvikyletspsveelkrlyqqlglnevrammrckeelykel nlgdsqlsddalfaamaehpklierpivvcngqarhgrppeqvleil | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.88 | Rfree | 0.189 | | Matthews' coefficent | 4.10 | Rfactor | 0.166 | | Waters | 301 | Solvent Content | 69.98 |
| Ligand Information | | Ligands | MLI (MALONATE) x 2 | | Metals | NA (SODIUM) x 1 | | |
