| Title | 1.82 Angstrom resolution crystal structure of holo-(acyl-carrier-protein) synthase (acpS) from Staphylococcus aureus. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00816 | | Molecular Characteristics | | Source | Staphylococcus aureus subsp. aureus col | | Alias Ids | TPS26769,93062, 57284929 | Molecular Weight | 13604.88 Da. | | Residues | 119 | Isoelectric Point | 6.65 | | Sequence | mihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatkeafskalgtgl gkhvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleksaf | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.82 | Rfree | 0.23220 | | Matthews' coefficent | 2.16 | Rfactor | 0.18949 | | Waters | 314 | Solvent Content | 43.16 |
| Ligand Information | | Ligands | | | Metals | | | |
