| Title | X-ray crystal structure of Spermidine n1-acetyltransferase from Vibrio cholerae. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01616 | | Molecular Characteristics | | Source | Vibrio cholerae o1 biovar el tor str. n16961 | | Alias Ids | TPS24754,243277, 9658384 | Molecular Weight | 20674.38 Da. | | Residues | 173 | Isoelectric Point | 5.60 | | Sequence | mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvvedaqknlig lvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhvavenpkavhlyeecg fveeghlveeffingryqdvkrmyilqskylnrse | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 2.38 | Rfree | 0.26040 | | Matthews' coefficent | 2.99 | Rfactor | 0.20542 | | Waters | 159 | Solvent Content | 58.82 |
| Ligand Information | | Ligands | IPA (ISOPROPYL) x 2 | | Metals | MG (MAGNESIUM) x 3 | | |
