| Title | The crystal structure of the thiJ/pfpI family protein from Bacillus anthracis. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01712 | | Molecular Characteristics | | Source | Bacillus anthracis str. ames ancestor | | Alias Ids | TPS24756,261594, 47551781 | Molecular Weight | 23571.04 Da. | | Residues | 210 | Isoelectric Point | 6.10 | | Sequence | mqtkkaflyvfntmsdweygyliaelnsgryfkkdlaplkvitvgankemittmgglrikpdisldect leskdllilpggttwseeihqpilerigqalkigtivaaicgatdalanmgyldtrkhtsnnleytkmv cpnykgekfyelgpavsdanlvtasgiaplefamevlkkidvftldalhswynlnkthkpeyffqlmns ink | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 6 | | Resolution (Å) | 2.30 | Rfree | 0.23661 | | Matthews' coefficent | 2.28 | Rfactor | 0.19005 | | Waters | 244 | Solvent Content | 46.11 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 1 | | Metals | | | |
