.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > CSGID > 3efb

3efb

    Page last modified 23:17, 22 Sep 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure of Probable sor Operon Regulator from Shigella flexneri. To be Published
    Site CSGID
    PDB Id 3efb Target Id IDP01531
    Molecular Characteristics
    Source Shigella flexneri 2a str. 301
    Alias Ids TPS24749,198214, 56384059 Molecular Weight 34974.96 Da.
    Residues 315 Isoelectric Point 5.35
    Sequence mensddirlivkiaqlyyeqdmtqaqiarelgiyrttisrllkrgrdqgmvtiainydynenlwleqql kqkfglkdvvvvsgndedeetqlammglhgaqlldrllepgdivgfswgravsalvenlpqagqsrqli cvpiiggpsgklesryhvntltysaaaklkgeshladfpalldnplirngimqsqhfktisaywdnldi alvgigspairdganwhafyggeesddlnarqvagdicsrffdihgamvetnmsektlsiemnklkqar ysigiamseekysgiigalrgkyinclvtnsstaelllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.249
    Matthews' coefficent 1.89 Rfactor 0.200
    Waters 499 Solvent Content 34.86

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch