| Title | Crystal Structure of Chloramphenicol Acetyltransferase VCA0300 from Vibrio cholerae O1 biovar eltor. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01350 | | Molecular Characteristics | | Source | Vibrio cholerae o1 biovar el tor str. n16961 | | Alias Ids | TPS24743,243277, 15601065 | Molecular Weight | 23548.30 Da. | | Residues | 209 | Isoelectric Point | 5.37 | | Sequence | mnfftspfsgipldqqvtnpniivgkhsyysgyyhghsfddcvrylhperddvdklvigsfcsigsgav fmmagnqghrsdwistfpffyqdndnfadardgftrsgdtiighdvwigteamimpgvkighgaiiasr svvtkdvapyevvgsnpakhikfrfsdveiamllemawwnwpeswlkesmqslcssdieglylnwqskart | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.61 | Rfree | 0.242 | | Matthews' coefficent | 2.57 | Rfactor | 0.175 | | Waters | 218 | Solvent Content | 52.11 |
| Ligand Information | | Ligands | MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 3 | | Metals | | | |
