| Title | Crystal structure of the Bacillus anthracis phenazine biosynthesis protein, PhzF family. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00051 | | Molecular Characteristics | | Source | Bacillus anthracis str. ames | | Alias Ids | TPS24713,198094, 30258008 | Molecular Weight | 33233.99 Da. | | Residues | 299 | Isoelectric Point | 4.78 | | Sequence | mktinvfhydaftnkpnmgnpagivldadglteeemqriaekvgfnetsfvlssevadirmryftpgye mdlcghgtvgtiyalrerglleekasltietkagilpiqigvnengetfikmrqtapqfkdfagskeel ahsiglevndldvslpivygstgnwtvivpvknldvcermkpnnevfpsvlkeipnasihpicletyde kvhmhgrhfssayagtiedpvtgtasgvmgayyatyvekdfdhemeliveqgqeihkdgrvtvyvtkdv eseklqidiagtavyvkefevli | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.50 | Rfree | 0.219 | | Matthews' coefficent | 2.19 | Rfactor | 0.180 | | Waters | 885 | Solvent Content | 43.95 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 15;SIN (SUCCINIC) x 1 | | Metals | MG (MAGNESIUM) x 1 | | |
