| Title | Crystal Structure of the Hexapeptide-Repeat Containing-Acetyltransferase VCA0836 from Vibrio cholerae. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01515 | | Related PDB Ids 3nz2 | | Molecular Characteristics | | Source | Vibrio cholerae o1 biovar el tor str. n16961 | | Alias Ids | TPS24745,243277, 15601591 | Molecular Weight | 21149.01 Da. | | Residues | 192 | Isoelectric Point | 5.64 | | Sequence | mkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscvqppfhce fgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqawetickpivieddvwi ggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrslkdpaesmae | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.51 | Rfree | 0.251 | | Matthews' coefficent | 2.12 | Rfactor | 0.193 | | Waters | 68 | Solvent Content | 42.11 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 2 | | |
