| Title | Crystal structure of the general stress protein 26 from Bacillus anthracis str. Sterne. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01540 | | Molecular Characteristics | | Source | Bacillus anthracis str. ames ancestor | | Alias Ids | TPS24752,261594, 47525694 | Molecular Weight | 16067.48 Da. | | Residues | 138 | Isoelectric Point | 5.57 | | Sequence | mhlkekittiiqgqrtgvlstvrndkphsafmmffhedfvlyvatdrqskkitdiennpnvhvllgreg kkldedyieveglasieedstlknkfwnnslkrwllrpedpnyvlikinpdtiyyidgagttepeflrl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.60 | Rfree | 0.227 | | Matthews' coefficent | 2.02 | Rfactor | 0.186 | | Waters | 88 | Solvent Content | 39.05 |
| Ligand Information | | Ligands | FAD (FLAVIN-ADENINE) x 1;SO4 (SULFATE) x 1 | | Metals | | | |
