| Title | Crystal structure of d-ribose high-affinity transport system from salmonella typhimurium lt2. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00079 | | Related PDB Ids 3dsa | | Molecular Characteristics | | Source | Salmonella enterica subsp. enterica serovar typhimurium str. lt2 | | Alias Ids | TPS24715,99287, 16422456 | Molecular Weight | 15188.64 Da. | | Residues | 139 | Isoelectric Point | 5.90 | | Sequence | mkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvvtremqveaail ateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqavirsgecspyanvilcagvtf | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 15 | | Resolution (Å) | 2.45 | Rfree | 0.23255 | | Matthews' coefficent | 2.59 | Rfactor | 0.19069 | | Waters | 282 | Solvent Content | 52.59 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 13 | | Metals | | | |
