| Title | Funded by the national institute of allergy and infectious diseases of nih (contract number hhsn272200700058c). To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00086 | | Related PDB Ids 3dr8 | | Molecular Characteristics | | Source | Salmonella enterica subsp. enterica serovar typhimurium str. lt2 | | Alias Ids | TPS24717,99287, 16420114 | Molecular Weight | 19186.76 Da. | | Residues | 171 | Isoelectric Point | 6.49 | | Sequence | mtirfadkadcaaiteiynhavlhtaaiwndrtvdtdnrlawyearqllgypvlvseengvvtgyasfg dwrsfdgfrytvehsvyvhpahqgkglgrkllsrlidearrcgkhvmvagiesqnaasirlhhslgftv taqmpqvgvkfgrwldltfmqlqldehaapdac | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 1.75 | Rfree | 0.20012 | | Matthews' coefficent | 2.80 | Rfactor | 0.16301 | | Waters | 811 | Solvent Content | 56.03 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 6;GOL (GLYCEROL) x 1 | | Metals | | | |
