| Title | The crystal structure of the putative tRNA synthase from Salmonella typhimurium LT2. To be Published 2008 | | Site | CSGID | | PDB Id | | Target Id | IDP00121 | | Molecular Characteristics | | Source | Salmonella enterica subsp. enterica serovar typhimurium str. lt2 | | Alias Ids | TPS24723,99287, 16766223 | Molecular Weight | 44788.44 Da. | | Residues | 420 | Isoelectric Point | 5.62 | | Sequence | mlkigviaddftgatdiasflvengmptvqindvptgtqpegcdavvislktrscpaqeaikqslaalv wlkkqgcqqvyfkycstfdstaegnigpvtdalmvaldtsftvispalpvngrtvyqgylfvmnhllae sgmrhhpinpmtdsylprlmeaqaqgrcgvipaqtldegvaatraalsrlqqegyryavldalnerhle iqgevlrdaplvtggsglamglarqwakhgvsqarsagyplsgravvlsgscsqmtnqqvafyrqhapt rdvdvarclssetreayaealaqwvlsqdselapmisatastqalaaiqqqygateashavealfslla arlaeggitrfivaggetsgvvtqslgitgfhigpcispgvpwvnalhapvslalksgnfgdesffira qrefqv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.70 | Rfree | 0.21048 | | Matthews' coefficent | 4.92 | Rfactor | 0.18836 | | Waters | 45 | Solvent Content | 75.00 |
| Ligand Information | | Ligands | | | Metals | | | |
