| Title | X-ray crystal structure of putative glycerate kinase 2 from Salmonella typhimurium LT2. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00122 | | Molecular Characteristics | | Source | Salmonella enterica subsp. enterica serovar typhimurium str. lt2 | | Alias Ids | TPS24725,99287, 16766265 | Molecular Weight | 39507.61 Da. | | Residues | 380 | Isoelectric Point | 5.09 | | Sequence | mkiviapdsykeslsalevataieqgfreiwpdadylklpladggegtveamveatagrivhvevtgpl ghrvnafyglsgdarsafiemaaasgleqvppaqrdplkttswgtgelirhaldagvehiiigiggsat ndggagmvqalgarlrdaqgndiaqggigletlasidisgldkrlsachievacdvtnpltgkegasav fgpqkgatpemierldtaltryahliardlhvdvldlagggaaggmgaalyafcgaqlrrgieivtdal hleacladadlvitgegridsqtihgkvpigvaniakrynkpvigiagsltadvsvvhehgldavfsvi ytictledalknasenvrmtarnvaatlkagqqlr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.23 | Rfree | 0.237 | | Matthews' coefficent | 2.35 | Rfactor | 0.188 | | Waters | 153 | Solvent Content | 47.73 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 2 | | Metals | CL (CHLORIDE) x 1 | | |
