| Title | Solution structure of Arabidopsis thaliana protein At5g39720.1, a member of the AIG2-like protein family. Acta Crystallogr.,Sect.F 62 490-493 2006 | | Site | CESG | | PDB Id | | Target Id | GO.22446 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30151, | Molecular Weight | 19101.89 Da. | | Residues | 165 | Isoelectric Point | 5.45 | | Sequence | mcssdslqlhnvfvygsfqdpdvinvmldrtpeivsatlpgfqrfrlkgrlypcivpsekgevhgkvlm gvtsdelenldavegneyervtvgivrednsekmavktymwinkadpdmfgewnfeewkrlhkkkfiet fkkimeckkkpqgqgnddishvlredq | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
