| Title | Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning. J.Biol.Chem. 281 20521-20529 2006 | | Site | CESG | | PDB Id | | Target Id | GO.36414 | | Related PDB Ids 2bdu 2g08 2g07 2g0a | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS30244, | Molecular Weight | 33788.22 Da. | | Residues | 297 | Isoelectric Point | 5.46 | | Sequence | mtnqesavhlkmmpefqkssvriknptrveeiicglikggaaklqiitdfdmtlsrfsyngkrcptchn iidncklvtdecrrkllqlkeqyyaievdpvltveekfpymvewytkshgllieqgipkaklkeivads dvmlkegyenffgklqqhgipvfifsagigdvleevirqagvyhsnvkvvsnfmdfdengvlkgfkgel ihvfnkhdgalkntdyfsqlkdnsniillgdsqgdlrmadgvanvehilkigylndrvdellekymdsy divlvkeeslevvnsilqktl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.25 | Rfree | 0.2193 | | Matthews' coefficent | 2.98 | Rfactor | 0.1548 | | Waters | 815 | Solvent Content | 58.79 |
| Ligand Information | | Ligands | PIN (PIPERAZINE-N,N'-BIS(2-ETHANESULFONIC) x 2 | | Metals | MG (MAGNESIUM) x 2 | | |
