| Title | Structure of the SCAN domain from the tumor suppressor protein MZF1. J.Mol.Biol. 363 137-147 2006 | | Site | CESG | | PDB Id | | Target Id | GO.79132 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS30189,6957 | Molecular Weight | 10379.27 Da. | | Residues | 92 | Isoelectric Point | 5.23 | | Sequence | dpgpeaarlrfrcfryeeatgpqealaqlrelcrqwlrpevrskeqmlellvleqflgalppeiqarvq gqrpgspeeaaalvdglrrepgg | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 2 |
| Ligand Information | | Ligands | | | Metals | | | |
