| Title | Micelle-induced folding of spinach thylakoid soluble phosphoprotein of 9 kDa and its functional implications. Biochemistry 45 15633-15643 2006 | | Site | CESG | | PDB Id | | Target Id | GO.78855 | | Molecular Characteristics | | Source | Spinacia oleracea | | Alias Ids | TPS30360,6926 | Molecular Weight | 8639.29 Da. | | Residues | 84 | Isoelectric Point | 9.78 | | Sequence | aakgtaetkqeksfvdwllgkitkedqfyetdpilrggdvkssgstsgkkggttsgkkgtvsipskkkn gnggvfgglfakkd. | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
