| Title | NMR Solution Structure of protein from Zebra Fish Dr.13312. To be Published | | Site | CESG | | PDB Id | | Target Id | GO.70875 | | Molecular Characteristics | | Source | Danio rerio | | Alias Ids | TPS30288, | Molecular Weight | 9483.28 Da. | | Residues | 85 | Isoelectric Point | 5.04 | | Sequence | msggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyiifrg sdikdltvceppkpim | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |