| Title | Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family. Biochemistry 45 14325-14336 2006 | | Site | CESG | | PDB Id | | Target Id | GO.6042 | | Related PDB Ids 2il4 1xmt | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30139,6338 | Molecular Weight | 11733.81 Da. | | Residues | 103 | Isoelectric Point | 7.86 | | Sequence | mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafehasshs isiipscsyvsdtflprnpswkplihsevfkssi | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
