| Title | NMR structure of the mengovirus Leader protein zinc-finger domain. Febs Lett. 582 896-900 2008 | | Site | CESG | | PDB Id | | Target Id | GO.79761 | | Molecular Characteristics | | Source | Mengovirus | | Alias Ids | TPS14657,6863 | Molecular Weight | 3721.06 Da. | | Residues | 32 | Isoelectric Point | 4.90 | | Sequence | mattmeqeicahsmtfeecpkcsalqyrngfy | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 1 | | |