| Title | Structure and mechanism of mouse cysteine dioxygenase. Proc.Natl.Acad.Sci.Usa 103 3084-3089 2006 | | Site | CESG | | PDB Id | | Target Id | GO.35683 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS30202, | Molecular Weight | 23024.71 Da. | | Residues | 200 | Isoelectric Point | 5.98 | | Sequence | mertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvdqgngk fnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksertlrenqcayindsig lhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhskfgirtpfttsgslenn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.75 | Rfree | 0.21555 | | Matthews' coefficent | 2.20 | Rfactor | 0.17885 | | Waters | 188 | Solvent Content | 43.60 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 1 | | Metals | NI (NICKEL) x 1 | | |
