| Title | The structure at 1.6 Angstroms resolution of the protein product of the At4g34215 gene from Arabidopsis thaliana. Acta Crystallogr.,Sect.D 61 1655-1661 2005 | | Site | CESG | | PDB Id | | Target Id | GO.22797 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30280, | Molecular Weight | 28356.70 Da. | | Residues | 260 | Isoelectric Point | 5.63 | | Sequence | meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsa dlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlyerm vkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqvaiasgggyi dkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnfc | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.60 | Rfree | 0.183 | | Matthews' coefficent | 2.30 | Rfactor | 0.1456 | | Waters | 1611 | Solvent Content | 46.80 |
| Ligand Information | | Ligands | | | Metals | | | |
