| Title | X-Ray Structure of Human Phosphomannomutase 2 (PMM2). To be Published | | Site | CESG | | PDB Id | | Target Id | GO.36653 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS30307, | Molecular Weight | 28080.70 Da. | | Residues | 246 | Isoelectric Point | 6.35 | | Sequence | maapgpalclfdvdgtltaprqkitkemddflqklrqkikigvvggsdfekvqeqlgndvvekydyvfp englvaykdgkllcrqniqshlgealiqdlinyclsyiakiklpkkrgtfiefrngmlnvspigrscsq eeriefyeldkkenirqkfvadlrkefagkgltfsiggqisfdvfpdgwdkryclrhvendgyktiyff gdktmpggndheiftdprtmgysvtapedtrricellfs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.09 | Rfree | 0.272 | | Matthews' coefficent | 2.60 | Rfactor | 0.199 | | Waters | 142 | Solvent Content | 51.90 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 1;GLY x 3 | | Metals | | | |
