| Title | X-Ray Structure of Gene Product from Homo Sapiens HS.95870. To be Published | | Site | CESG | | PDB Id | | Target Id | GO.33759 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS30214, | Molecular Weight | 13331.56 Da. | | Residues | 122 | Isoelectric Point | 8.58 | | Sequence | mtspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekgvqtlvigr gmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.59 | Rfree | 0.257 | | Matthews' coefficent | 2.20 | Rfactor | 0.193 | | Waters | 104 | Solvent Content | 44.30 |
| Ligand Information | | Ligands | | | Metals | | | |
