| Title | X-Ray Structure of Protein from Mus Musculus MM.29898. To be Published | | Site | CESG | | PDB Id | | Target Id | GO.34455 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS30319, | Molecular Weight | 18793.88 Da. | | Residues | 170 | Isoelectric Point | 4.93 | | Sequence | mstagdgergtvgqedsaaarpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelae lfqwksdtepgpqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqrypvhlsrgsa ckytdlprgtisenqavgagdpaselrdqast | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.32 | Rfree | 0.239 | | Matthews' coefficent | 2.50 | Rfactor | 0.21 | | Waters | 24 | Solvent Content | 49.60 |
| Ligand Information | | Ligands | | | Metals | | | |
