| Title | X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210. Proteins 65 1051-1054 2006 | | Site | CESG | | PDB Id | | Target Id | GO.9733 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30179, | Molecular Weight | 19221.96 Da. | | Residues | 178 | Isoelectric Point | 5.74 | | Sequence | meikgesmqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg rhltgetvgevravadmhqrkaemakhsdafialpggygtleellevitwaqlgihdkpvgllnvdgyy nsllsfidkaveegfisptareiivsaptakelvkklevn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.95 | Rfree | 0.234 | | Matthews' coefficent | 1.90 | Rfactor | 0.181 | | Waters | 222 | Solvent Content | 34.00 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 2 | | Metals | MG (MAGNESIUM) x 1 | | |
