| Title | The structure and NO binding properties of the nitrophorin-like heme-binding protein from Arabidopsis thaliana gene locus At1g79260.1. Proteins 78 917-931 2010 | | Site | CESG | | PDB Id | | Target Id | GO.6462 | | Related PDB Ids 3emm | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS29815, | Molecular Weight | 18485.08 Da. | | Residues | 166 | Isoelectric Point | 6.92 | | Sequence | mnqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwkl esgapmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisrefelv dgklsyvvrmstttnplqphlkaildkl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.32 | Rfree | 0.186 | | Matthews' coefficent | 2.40 | Rfactor | 0.156 | | Waters | 329 | Solvent Content | 48.50 |
| Ligand Information | | Ligands | | | Metals | | | |
