| Title | X-ray structure of protein from arabidopsis thaliana AT5G01750. To be published | | Site | CESG | | PDB Id | | Target Id | GO.24556 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS29796, | Molecular Weight | 24293.70 Da. | | Residues | 217 | Isoelectric Point | 8.35 | | Sequence | meqpyvyaypqgsgpsgaptpqaggvvvdpkycapypidmaivrkmmsltdgnfvitdvngnllfkvke pvfglhdkrvlldgsgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvkrssmlqlktkldvflghn kdekrcdfrvkgswlerscvvyagesdaivaqmhrkhtvqsvflgkdnfsvtvypnvdyafiaslvvil ddvnredraa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.70 | Rfree | 0.231 | | Matthews' coefficent | 2.50 | Rfactor | 0.189 | | Waters | 127 | Solvent Content | 50.20 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 1 | | Metals | | | |
