| Title | The structure at 2.5 A resolution of human basophilic leukemia-expressed protein BLES03. Acta Crystallogr.,Sect.F 61 812-817 2005 | | Site | CESG | | PDB Id | | Target Id | GO.36704 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS29813, | Molecular Weight | 27381.32 Da. | | Residues | 251 | Isoelectric Point | 5.41 | | Sequence | mepgeeleeegspggredgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpg spnsepvgwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapgfk ldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaagikclltykpdv ytylgiyranrwhlcptlyesrfqlggsargsrvldrannvelt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.50 | Rfree | 0.245 | | Matthews' coefficent | 3.00 | Rfactor | 0.188 | | Waters | 217 | Solvent Content | 58.80 |
| Ligand Information | | Ligands | | | Metals | | | |
