| Title | The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein. Protein Sci. 17 571-576 2008 | | Site | CESG | | PDB Id | | Target Id | GO.33810 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS30258,6682 | Molecular Weight | 13168.13 Da. | | Residues | 116 | Isoelectric Point | 8.64 | | Sequence | mkakrrrpdldeihrelrpqgsarpqpdpnaefdpdlpggglhrclacaryfidstnlkthfrskdhkk rlkqlsvepysqeeaeraagmgsyvpprrlavptevstevpemdtst | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 1 | | |
