| Title | Structure and Mechanism of an ADP-Glucose Phosphorylase from Arabidopsis thaliana. Biochemistry 45 3154-3162 2006 | | Site | CESG | | PDB Id | | Target Id | GO.23169 | | Related PDB Ids 1zwj 2h39 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30208, | Molecular Weight | 39003.20 Da. | | Residues | 351 | Isoelectric Point | 6.19 | | Sequence | mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkpsscpfcigr eqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivgfgfhdvviespvhsiqls didpvgigdiliaykkrinqiaqhdsinyiqvfknqgasagasmshshsqmmalpvvpptvssrldgtk dyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllkl mlqkiakqlndppynymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvm revslt | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.83 | Rfree | 0.231 | | Matthews' coefficent | 2.40 | Rfactor | 0.186 | | Waters | 500 | Solvent Content | 47.40 |
| Ligand Information | | Ligands | AMP (ADENOSINE) x 2;EDO (1,2-ETHANEDIOL) x 6 | | Metals | ZN (ZINC) x 4 | | |
