| Title | Inhibition of human pancreatic ribonuclease by the human ribonuclease inhibitor protein. J.Mol.Biol. 368 434-449 2007 | | Site | CESG | | PDB Id | | Target Id | GO.78623 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS30157, | Molecular Weight | 49970.45 Da. | | Residues | 461 | Isoelectric Point | 4.71 | | Sequence | msldiqsldiqceelsdarwaellpllqqcqvvrlddcgltearckdissalrvnpalaelnlrsnelg dvgvhcvlqglqtpsckiqklslqnccltgagcgvlsstlrtlptlqelhlsdnllgdaglqllcegll dpqcrleklqleycslsaasceplasvlrakpdfkeltvsnndineagvrvlcqglkdspcqlealkle scgvtsdncrdlcgivaskaslrelalgsnklgdvgmaelcpgllhpssrlrtlwiwecgitakgcgdl crvlrakeslkelslagnelgdegarllcetllepgcqleslwvkscsftaaccshfssvlaqnrflle lqisnnrledagvrelcqglgqpgsvlrvlwladcdvsdsscsslaatllanhslreldlsnnclgdag ilqlvesvrqpgclleqlvlydiywseemedrlqalekdkpslrvis | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.95 | Rfree | 0.236 | | Matthews' coefficent | 2.30 | Rfactor | 0.175 | | Waters | 854 | Solvent Content | 46.50 |
| Ligand Information | | Ligands | CIT (CITRIC) x 1 | | Metals | | | |
