| Title | Solution Structure of a putative late embryogenesis abundant (LEA) protein At2g46140.1. To be Published | | Site | CESG | | PDB Id | | Target Id | GO.9943 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30278,6515 | Molecular Weight | 17845.39 Da. | | Residues | 166 | Isoelectric Point | 4.53 | | Sequence | masadekvveekasvisslldkakgffaeklaniptpeatvddvdfkgvtrdgvdyhakvsvknpysqs ipicqisyilksatrtiasgtipdpgslvgsgttvldvpvkvaysiavslmkdmctdwdidyqldiglt fdipvvgditipvstqgeiklpslrdff | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
