| Title | Solution NMR structure of At5g01610, an Arabidopsis thaliana protein containing DUF538 domain. To be Published | | Site | CESG | | PDB Id | | Target Id | GO.24315 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS29817,6443 | Molecular Weight | 19067.99 Da. | | Residues | 170 | Isoelectric Point | 9.14 | | Sequence | mdqifnkvgsywlgqkankqfdsvgndlnsvstsieggtkwlvnkikgkmqkplpellkeydlpigifp gdatnyefdeetkkltvlipsicevgykdssvlkftttvtghlekgkltdvegiktkvmiwvkvtsist daskvyftagmkksrsrdayevqrnglrvdkf | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
