| Title | X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210. Proteins 65 1051-1054 2006 | | Site | CESG | | PDB Id | | Target Id | GO.19912 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30161, | Molecular Weight | 23773.05 Da. | | Residues | 215 | Isoelectric Point | 5.40 | | Sequence | mednqrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyegglhvl giipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpgygtmeellemitwsqlgihkktvg llnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekmeeytpshmhvasheswkveelgdy pgqenkpq | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.15 | Rfree | 0.213 | | Matthews' coefficent | 2.49 | Rfactor | 0.159 | | Waters | 319 | Solvent Content | 50.63 |
| Ligand Information | | Ligands | NO3 (NITRATE) x 1;EDO (1,2-ETHANEDIOL) x 4 | | Metals | | | |
