| Title | Solution structure of isoform 1 of Roadblock/LC7, a light chain in the dynein complex. J.Mol.Biol. 354 1043-1051 2005 | | Site | CESG | | PDB Id | | Target Id | GO.34382 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS30145,6396 | Molecular Weight | 10989.13 Da. | | Residues | 96 | Isoelectric Point | 6.58 | | Sequence | maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilkarstvreidpqndltfl rirskkneimvapdkdyfliviqnpte | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 2 |
| Ligand Information | | Ligands | | | Metals | | | |
