.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > CESG > 1y0z

1y0z

    Page last modified 04:46, 23 Sep 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The structure at 2.4 A resolution of the protein from gene locus At3g21360, a putative Fe(II)/2-oxoglutarate-dependent enzyme from Arabidopsis thaliana. Acta Crystallogr.,Sect.F 61 469-472 2005
    Site CESG
    PDB Id 1y0z Target Id GO.13167
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30193, Molecular Weight 37209.55 Da.
    Residues 330 Isoelectric Point 5.70
    Sequence maelllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhesgavlfrgf pvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhemaqvrefpsklffyce iepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlgedddpsspigrgwkstflthdknla eqravdlgmklewtedggaktvmgpipaikydesrnrkvwfnsmvaaytgwedkrndprkavtfgdgkp lpadivhdclrileeecvavpwqrgdvllidnwavlhsrrpfdpprrvlaslck
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.241
    Matthews' coefficent 2.90 Rfactor 0.193
    Waters 780 Solvent Content 57.64

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals FE2 (FE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch