| Title | X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT2G19940. To be Published | | Site | CESG | | PDB Id | | Target Id | GO.9383 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30260, | Molecular Weight | 39598.48 Da. | | Residues | 359 | Isoelectric Point | 6.50 | | Sequence | msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqkl ptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkavelqk evvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgvsgagrgakeanly seiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirgmqstiyvemapgvrtedlhqql ktsyedeefvkvldegvvprthnvrgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlg ypettgllhqplfp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.19 | Rfree | 0.208 | | Matthews' coefficent | 2.14 | Rfactor | 0.187 | | Waters | 956 | Solvent Content | 42.63 |
| Ligand Information | | Ligands | | | Metals | | | |
