| Title | X-ray Structure of Gene Product from Arabidopsis Thaliana At5g02240. To be published | | Site | CESG | | PDB Id | | Target Id | GO.23662 | | Related PDB Ids 1ybm | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS30195, | Molecular Weight | 27101.48 Da. | | Residues | 253 | Isoelectric Point | 6.20 | | Sequence | manlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdadsinpafqg idalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaakvagvkhivvvgsmggtn pdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvgkddellqtdtktvprad vaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvtsrf | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.2776 | | Matthews' coefficent | 2.51 | Rfactor | 0.2183 | | Waters | 400 | Solvent Content | 51.00 |
| Ligand Information | | Ligands | NAP (NADP) x 2 | | Metals | | | |
