| Title | Solution structure of At3g04780.1-des15, an Arabidopsis thaliana ortholog of the C-terminal domain of human thioredoxin-like protein. Protein Sci. 14 1059-1063 2005 | | Site | CESG | | PDB Id | | Target Id | GO.11624 | | Molecular Characteristics | | Source | Arabidopsis thaliana columbia | | Alias Ids | TPS29811,6341 | Molecular Weight | 17943.24 Da. | | Residues | 161 | Isoelectric Point | 4.87 | | Sequence | msaesasqipkgqvdlldfidwsgveclnqssshslpnalkqgyredeglnlesdadeqlliyipfnqv iklhsfaikgpeeegpktvkffsnkehmcfsnvndfppsdtaelteenlkgkpvvlkyvkfqnvrslti fieanqsgsevtkvqkialygst | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
