| Title | Three-dimensional structure of the AAH26994.1 protein from Mus musculus, a putative eukaryotic Urm1. Protein Sci. 14 2095-2102 2005 | | Site | CESG | | PDB Id | | Target Id | GO.34198 | | Molecular Characteristics | | Source | Mus musculus | | Alias Ids | TPS30187,6337 | Molecular Weight | 11322.48 Da. | | Residues | 101 | Isoelectric Point | 4.61 | | Sequence | maaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqgdsvrpgilv lindadwellgeldyqlqdqdsilfistlhgg | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
